PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID WALNUT_00014943-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fagales; Juglandaceae; Juglans
Family NF-YB
Protein Properties Length: 237aa    MW: 26080.6 Da    PI: 5.6342
Description NF-YB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
WALNUT_00014943-RAgenomeJHUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YB173.91.6e-5425120297
               NF-YB   2 reqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyre 92 
                         +eqdrflPianvsrimkk lPanakisk+aketvqecvse+isf+t+easdkcqrekrktingddllwa++ lGfe+yv pl+ yl kyre
  WALNUT_00014943-RA  25 KEQDRFLPIANVSRIMKKSLPANAKISKEAKETVQECVSEYISFITGEASDKCQREKRKTINGDDLLWAMTILGFENYVGPLRNYLGKYRE 115
                         79***************************************************************************************** PP

               NF-YB  93 legek 97 
                         +eg+k
  WALNUT_00014943-RA 116 TEGDK 120
                         ***98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.20.108.8E-5223143IPR009072Histone-fold
SuperFamilySSF471134.66E-3927134IPR009072Histone-fold
PfamPF008081.1E-263094IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
PRINTSPR006151.6E-175876No hitNo description
PROSITE patternPS0068506177IPR003956Transcription factor, NFYB/HAP3, conserved site
PRINTSPR006151.6E-177795No hitNo description
PRINTSPR006151.6E-1796114No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 237 aa     Download sequence    Send to blast
MTGKRSQTSP DVGSPSSGDI MISLKEQDRF LPIANVSRIM KKSLPANAKI SKEAKETVQE  60
CVSEYISFIT GEASDKCQRE KRKTINGDDL LWAMTILGFE NYVGPLRNYL GKYRETEGDK  120
TSMARQGDQS PTDSYTDHGT NYNDQIHRAM SSSTTTANSV VATADFQRFS GGFYSFGTQV  180
NPDSYGESSG RSGTGYEDQN MVIGAFKGNE FCENGNGNGN RAVAQAHDHL HHDVVEW
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4g91_B4e-4624115192Transcription factor HapC (Eurofung)
4g92_B4e-4624115192Transcription factor HapC (Eurofung)
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006493850.12e-90PREDICTED: nuclear transcription factor Y subunit B-3-like
TrEMBLA0A067F1F41e-90A0A067F1F4_CITSI; Uncharacterized protein
STRINGPOPTR_0005s08510.12e-80(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF59134150
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G14540.12e-62nuclear factor Y, subunit B3